GTPBP10 antibody
-
- Target See all GTPBP10 Antibodies
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
-
Reactivity
- Human, Mouse, Rat, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GTPBP10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS
- Top Product
- Discover our top product GTPBP10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GTPBP10 (GTP-Binding Protein 10 (GTPBP10))
- Alternative Name
- GTPBP10 (GTPBP10 Products)
- Synonyms
- zgc:92334 antibody, ObgH2 antibody, 4930545J22Rik antibody, BC034507 antibody, Cldn12 antibody, GTP-binding protein 10 (putative) antibody, GTP binding protein 10 antibody, gtpbp10 antibody, GTPBP10 antibody, Gtpbp10 antibody
- Background
- Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.
- Molecular Weight
- 43 kDa (MW of target protein)
-