GTPBP10 antibody

Catalog No. ABIN630593

Product Details anti-GTPBP10 Antibody

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTPBP10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTPBP10

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Alternative Name: GTPBP10 (GTPBP10 Products)

Synonyms: zgc:92334 antibody, ObgH2 antibody, 4930545J22Rik antibody, BC034507 antibody, Cldn12 antibody, GTP-binding protein 10 (putative) antibody, GTP binding protein 10 antibody, gtpbp10 antibody, GTPBP10 antibody, Gtpbp10 antibody

Background: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Molecular Weight: 43 kDa (MW of target protein)