PDSS2 antibody
-
- Target See all PDSS2 Antibodies
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDSS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
- Top Product
- Discover our top product PDSS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDSS2 Blocking Peptide, catalog no. 33R-4010, is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
- Alternative Name
- PDSS2 (PDSS2 Products)
- Synonyms
- dlp1 antibody, C6orf210 antibody, COQ10D3 antibody, DLP1 antibody, bA59I9.3 antibody, hDLP1 antibody, zgc:92156 antibody, 5430420P03Rik antibody, Gm60 antibody, Plmp antibody, kd antibody, mDLP1 antibody, decaprenyl diphosphate synthase subunit 2 antibody, prenyl (decaprenyl) diphosphate synthase, subunit 2 antibody, decaprenyl-diphosphate synthase subunit 2 antibody, decaprenyl diphosphate synthase subunit 2 Dlp1 antibody, prenyl (solanesyl) diphosphate synthase, subunit 2 antibody, PDSS2 antibody, pdss2 antibody, CpipJ_CPIJ016311 antibody, SJAG_01865 antibody, Tsp_08290 antibody, Pdss2 antibody
- Background
- The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.
- Molecular Weight
- 44 kDa (MW of target protein)
-