DONSON antibody (Middle Region)

Catalog No. ABIN630570

Product Details anti-DONSON Antibody

Target: DONSON (Downstream Neighbor of SON (DONSON))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DONSON antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DONSON antibody was raised against the middle region of DONSON

Purification: Affinity purified

Immunogen: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DONSON Blocking Peptide, catalog no. 33R-2048, is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DONSON

Target: DONSON (Downstream Neighbor of SON (DONSON))

Alternative Name: DONSON (DONSON Products)

Background: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Molecular Weight: 63 kDa (MW of target protein)