CRYM antibody (Middle Region)

Catalog No. ABIN630565

Product Details anti-CRYM Antibody

Target: CRYM (Crystallin, mu (CRYM))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRYM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Crystallin Mu antibody was raised against the middle region of CRYM

Purification: Affinity purified

Immunogen: Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Crystallin Mu Blocking Peptide, catalog no. 33R-1248, is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRYM

Target: CRYM (Crystallin, mu (CRYM))

Alternative Name: Crystallin mu (CRYM Products)

Synonyms: CRYM antibody, zgc:158843 antibody, DFNA40 antibody, THBP antibody, crystallin mu antibody, crystallin, mu antibody, Cro/Cl family transcriptional regulator antibody, crystallin mu L homeolog antibody, CRYM antibody, crym antibody, EAMY_RS27495 antibody, crym.L antibody, Crym antibody

Background: Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Hormone Transport, Sensory Perception of Sound