IFRD1 antibody (N-Term)

Catalog No. ABIN630559

Product Details anti-IFRD1 Antibody

Target: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFRD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IFRD1 antibody was raised against the N terminal of IFRD1

Purification: Affinity purified

Immunogen: IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFRD1 Blocking Peptide, catalog no. 33R-9754, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFRD1

Target: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Alternative Name: IFRD1 (IFRD1 Products)

Synonyms: im:7067566 antibody, si:dkey-192l17.2 antibody, wu:fi35f04 antibody, wu:fj67a06 antibody, zgc:154080 antibody, IFR1 antibody, PC4 antibody, TIS7 antibody, Ifnl antibody, Tis7 antibody, Pc4 antibody, interferon-related developmental regulator 1 antibody, interferon related developmental regulator 1 L homeolog antibody, interferon related developmental regulator 1 antibody, ifrd1 antibody, ifrd1.L antibody, IFRD1 antibody, Ifrd1 antibody

Background: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Molecular Weight: 50 kDa (MW of target protein)