CKM antibody (Middle Region)
-
- Target See all CKM Antibodies
- CKM (Creatine Kinase, Muscle (CKM))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CKM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CKMM antibody was raised against the middle region of CKM
- Purification
- Affinity purified
- Immunogen
- CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
- Top Product
- Discover our top product CKM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CKMM Blocking Peptide, catalog no. 33R-3630, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
: "
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
-
- Target
- CKM (Creatine Kinase, Muscle (CKM))
- Alternative Name
- CKMM (CKM Products)
- Synonyms
- CKMM antibody, M-CK antibody, Ckmm antibody, MCK antibody, ckmm antibody, m-ck antibody, CKM antibody, CK-M antibody, cb51 antibody, ckm antibody, mck antibody, wu:fa28d05 antibody, ckm3 antibody, wu:fb55e09 antibody, zgc:64204 antibody, zgc:92070 antibody, creatine kinase, M-type antibody, creatine kinase, muscle antibody, creatine kinase, M-type L homeolog antibody, creatine kinase, muscle a antibody, creatine kinase, muscle b antibody, CKM antibody, Ckm antibody, ckm.L antibody, ckm antibody, ckma antibody, ckmb antibody
- Background
- CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.
- Molecular Weight
- 43 kDa (MW of target protein)
-