KRTAP24-1 antibody (Middle Region)

Catalog No. ABIN630548

Product Details anti-KRTAP24-1 Antibody

Target: KRTAP24-1 (Keratin Associated Protein 24-1 (KRTAP24-1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRTAP24-1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KAP24.1 antibody was raised against the middle region of KRTAP24-1

Purification: Affinity purified

Immunogen: KAP24.1 antibody was raised using the middle region of KRTAP24-1 corresponding to a region with amino acids LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KAP24.1 Blocking Peptide, catalog no. 33R-5538, is also available for use as a blocking control in assays to test for specificity of this KAP24.1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP24-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRTAP24-1

Target: KRTAP24-1 (Keratin Associated Protein 24-1 (KRTAP24-1))

Alternative Name: KAP24.1 (KRTAP24-1 Products)

Synonyms: KAP24.1 antibody, keratin associated protein 24-1 antibody, KRTAP24-1 antibody

Background: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Molecular Weight: 28 kDa (MW of target protein)