KRTAP24-1 antibody (Middle Region)
-
- Target See all KRTAP24-1 Antibodies
- KRTAP24-1 (Keratin Associated Protein 24-1 (KRTAP24-1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KRTAP24-1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KAP24.1 antibody was raised against the middle region of KRTAP24-1
- Purification
- Affinity purified
- Immunogen
- KAP24.1 antibody was raised using the middle region of KRTAP24-1 corresponding to a region with amino acids LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC
- Top Product
- Discover our top product KRTAP24-1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KAP24.1 Blocking Peptide, catalog no. 33R-5538, is also available for use as a blocking control in assays to test for specificity of this KAP24.1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP24-1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRTAP24-1 (Keratin Associated Protein 24-1 (KRTAP24-1))
- Alternative Name
- KAP24.1 (KRTAP24-1 Products)
- Synonyms
- KAP24.1 antibody, keratin associated protein 24-1 antibody, KRTAP24-1 antibody
- Background
- In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
- Molecular Weight
- 28 kDa (MW of target protein)
-