PWP2 antibody

Catalog No. ABIN630541

Product Details anti-PWP2 Antibody

Target: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PWP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PWP2 Blocking Peptide, catalog no. 33R-9762, is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PWP2

Target: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Alternative Name: PWP2 (PWP2H Products)

Synonyms: 6530411D08Rik antibody, Pwp2h antibody, wdp103 antibody, EHOC-17 antibody, PWP2H antibody, UTP1 antibody, cb471 antibody, zgc:56063 antibody, PWP2 periodic tryptophan protein homolog (yeast) antibody, PWP2, small subunit processome component antibody, Pwp2 antibody, PWP2 antibody, pwp2h antibody

Background: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Molecular Weight: 102 kDa (MW of target protein)