PRDM15 antibody (Middle Region)
-
- Target See all PRDM15 Antibodies
- PRDM15 (PR Domain Containing 15 (PRDM15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRDM15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRDM15 antibody was raised against the middle region of PRDM15
- Purification
- Affinity purified
- Immunogen
- PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP
- Top Product
- Discover our top product PRDM15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRDM15 Blocking Peptide, catalog no. 33R-4819, is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRDM15 (PR Domain Containing 15 (PRDM15))
- Alternative Name
- PRDM15 (PRDM15 Products)
- Synonyms
- C21orf83 antibody, PFM15 antibody, ZNF298 antibody, E130018M06Rik antibody, ORF62 antibody, Zfp298 antibody, PR domain containing 15 antibody, PR domain zinc finger protein 15 antibody, PR/SET domain 15 antibody, prdm15 antibody, LOC722504 antibody, PRDM15 antibody, Prdm15 antibody
- Background
- PRDM15 may be involved in transcriptional regulation.
- Molecular Weight
- 134 kDa (MW of target protein)
-