SH3BGR antibody (N-Term)

Catalog No. ABIN630536

Product Details anti-SH3BGR Antibody

Target: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3BGR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 BGR antibody was raised against the N terminal of SH3 GR

Purification: Affinity purified

Immunogen: SH3 BGR antibody was raised using the N terminal of SH3 GR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3BGR Blocking Peptide, catalog no. 33R-1691, is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3BGR

Target: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Alternative Name: SH3BGR (SH3BGR Products)

Synonyms: 21-garp antibody, MGC82574 antibody, Sh3bgr antibody, ACYPI008600 antibody, RGD1563599 antibody, 21-GARP antibody, 5430437A18Rik antibody, SH3 domain binding glutamate-rich protein L homeolog antibody, SH3 domain binding glutamic acid-rich protein antibody, SH3 domain binding glutamate-rich protein antibody, SH3 domain binding glutamate rich protein antibody, SH3-binding domain glutamic acid-rich protein antibody, sh3bgr.L antibody, Sh3bgr antibody, SH3BGR antibody

Background: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.

Molecular Weight: 26 kDa (MW of target protein)