SH3BGR antibody (N-Term)
-
- Target See all SH3BGR products
- SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SH3BGR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SH3 BGR antibody was raised against the N terminal of SH3 GR
- Purification
- Affinity purified
- Immunogen
- SH3 BGR antibody was raised using the N terminal of SH3 GR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SH3BGR Blocking Peptide, catalog no. 33R-1691, is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))
- Alternative Name
- SH3BGR (SH3BGR Products)
- Background
- SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.
- Molecular Weight
- 26 kDa (MW of target protein)
-