CC2D1B antibody (C-Term)

Catalog No. ABIN630531

Product Details anti-CC2D1B Antibody

Target: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CC2D1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CC2 D2 antibody was raised against the C terminal of CC2 2

Purification: Affinity purified

Immunogen: CC2 D2 antibody was raised using the C terminal of CC2 2 corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CC2D1B Blocking Peptide, catalog no. 33R-4207, is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CC0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CC2D1B

Target: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Alternative Name: CC2D1B (CC2D1B Products)

Synonyms: MGC68887 antibody, fb71c02 antibody, wu:fb71c02 antibody, A830039B04Rik antibody, Freud2 antibody, RGD1306630 antibody, coiled-coil and C2 domain containing 1B L homeolog antibody, coiled-coil and C2 domain containing 1B antibody, cc2d1b.L antibody, CC2D1B antibody, cc2d1b antibody, Cc2d1b antibody

Background: CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.

Molecular Weight: 41 kDa (MW of target protein)