AGBL5 antibody (C-Term)

Catalog No. ABIN630529

Product Details anti-AGBL5 Antibody

Target: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGBL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AGBL5 antibody was raised against the C terminal of AGBL5

Purification: Affinity purified

Immunogen: AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGBL5 Blocking Peptide, catalog no. 33R-6772, is also available for use as a blocking control in assays to test for specificity of this AGBL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGBL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGBL5

Target: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Alternative Name: AGBL5 (AGBL5 Products)

Synonyms: zgc:91997 antibody, MGC83526 antibody, AGBL5 antibody, ccp5 antibody, 4930455N08 antibody, 9430057O19Rik antibody, CCP5 antibody, ATP/GTP binding protein-like 5 antibody, ATP/GTP binding protein-like 5 L homeolog antibody, ATP/GTP binding protein like 5 antibody, cytosolic carboxypeptidase-like protein 5 antibody, agbl5 antibody, agbl5.L antibody, AGBL5 antibody, LOC100181588 antibody, Agbl5 antibody

Background: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Molecular Weight: 47 kDa (MW of target protein)