SQLE antibody (C-Term)

Catalog No. ABIN630528

Product Details anti-SQLE Antibody

Target: SQLE (Squalene Epoxidase (SQLE))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SQLE antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SQLE antibody was raised against the C terminal of SQLE

Purification: Affinity purified

Immunogen: SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SQLE Blocking Peptide, catalog no. 33R-4493, is also available for use as a blocking control in assays to test for specificity of this SQLE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SQLE

Target: SQLE (Squalene Epoxidase (SQLE))

Alternative Name: SQLE (SQLE Products)

Synonyms: An03g03770 antibody, AO090701000685 antibody, AI323792 antibody, squalene epoxidase antibody, SQLE antibody, ANI_1_450034 antibody, AOR_1_1218114 antibody, CC1G_03987 antibody, BDBG_08449 antibody, MCYG_02365 antibody, TERG_05717 antibody, Sqle antibody

Background: Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Molecular Weight: 39 kDa (MW of target protein)