SQLE antibody (C-Term)
-
- Target See all SQLE Antibodies
- SQLE (Squalene Epoxidase (SQLE))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SQLE antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SQLE antibody was raised against the C terminal of SQLE
- Purification
- Affinity purified
- Immunogen
- SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
- Top Product
- Discover our top product SQLE Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SQLE Blocking Peptide, catalog no. 33R-4493, is also available for use as a blocking control in assays to test for specificity of this SQLE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SQLE (Squalene Epoxidase (SQLE))
- Alternative Name
- SQLE (SQLE Products)
- Background
- Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
- Molecular Weight
- 39 kDa (MW of target protein)
-