CCDC46 antibody (C-Term)
-
- Target See all CCDC46 Antibodies
- CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC46 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CCDC46 antibody was raised against the C terminal of CCDC46
- Purification
- Affinity purified
- Immunogen
- CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED
- Top Product
- Discover our top product CCDC46 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC46 Blocking Peptide, catalog no. 33R-3942, is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))
- Alternative Name
- CCDC46 (CCDC46 Products)
- Background
- CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-