CCDC46 antibody (C-Term)

Catalog No. ABIN630527

Product Details anti-CCDC46 Antibody

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC46 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC46 antibody was raised against the C terminal of CCDC46

Purification: Affinity purified

Immunogen: CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC46 Blocking Peptide, catalog no. 33R-3942, is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC46

Target: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Alternative Name: CCDC46 (CCDC46 Products)

Synonyms: CCDC46 antibody, MACOCO antibody, 1700001M19Rik antibody, 1700029K01Rik antibody, 8430407H02Rik antibody, AV043680 antibody, AV207351 antibody, Ccdc46 antibody, Macoco antibody, RGD1564168 antibody, centrosomal protein 112 antibody, centrosomal protein of 112 kDa antibody, CEP112 antibody, Cep112 antibody, LOC100523204 antibody, LOC100541423 antibody, cep112 antibody

Background: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome