Septin 6 antibody (N-Term)

Catalog No. ABIN630523

Product Details anti-Septin 6 Antibody

Target: Septin 6 (SEPT6)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Septin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Septin 6 antibody was raised against the N terminal of 40427

Purification: Affinity purified

Immunogen: Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 38961 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Septin 6

Target: Septin 6 (SEPT6)

Alternative Name: Septin 6 (SEPT6 Products)

Synonyms: SEP2 antibody, SEPT2 antibody, sept11 antibody, SEPT11 antibody, 2810035H17Rik antibody, C920001C06Rik antibody, Sep6 antibody, mKIAA0128 antibody, Sep2 antibody, fc54b04 antibody, wu:fb70g05 antibody, wu:fc54b04 antibody, wu:fl76c07 antibody, zgc:66071 antibody, septin-6 antibody, septin 6 antibody, septin 6 L homeolog antibody, SEPT6 antibody, sept6.L antibody, Sept6 antibody, sept6 antibody, LOC100220762 antibody

Background: SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

Molecular Weight: 12 kDa (MW of target protein)