IL13RA2 antibody (N-Term)

Catalog No. ABIN630522

Product Details anti-IL13RA2 Antibody

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL13RA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL13 RA2 antibody was raised against the N terminal of IL13 A2

Purification: Affinity purified

Immunogen: IL13 RA2 antibody was raised using the N terminal of IL13 A2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL13RA2 Blocking Peptide, catalog no. 33R-1973, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL13RA2

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Alternative Name: IL13RA2 (IL13RA2 Products)

Background: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Molecular Weight: 22 kDa (MW of target protein)