DLC1 antibody (C-Term)
-
- Target See all DLC1 Antibodies
- DLC1 (Deleted in Liver Cancer 1 (DLC1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DLC1 antibody was raised against the C terminal of DLC1
- Purification
- Affinity purified
- Immunogen
- DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
- Top Product
- Discover our top product DLC1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLC1 Blocking Peptide, catalog no. 33R-6752, is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLC1 (Deleted in Liver Cancer 1 (DLC1))
- Alternative Name
- DLC1 (DLC1 Products)
- Background
- This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Tube Formation, Positive Regulation of Endopeptidase Activity
-