HBS1L antibody

Catalog No. ABIN630516

Product Details anti-HBS1L Antibody

Target: HBS1L (HBS1-Like (HBS1L))

Reactivity: Hepatitis B Virus (HBV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBS1L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HBS1L

Target: HBS1L (HBS1-Like (HBS1L))

Abstract: HBS1L Products

Target Type: Viral Protein

Background: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Molecular Weight: 22 kDa (MW of target protein)