Retinoid X Receptor gamma antibody (N-Term)
-
- Target See all Retinoid X Receptor gamma (RXRG) Antibodies
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoid X Receptor gamma antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RXRG antibody was raised against the N terminal of RXRG
- Purification
- Affinity purified
- Immunogen
- RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
- Top Product
- Discover our top product RXRG Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
- Alternative Name
- RXRG (RXRG Products)
- Synonyms
- NR2B3 antibody, RXRC antibody, zgc:92183 antibody, RXRgamma antibody, RXRG antibody, RXR-gamma antibody, nr2b3 antibody, xrxrg antibody, rxrc antibody, Nr2b3 antibody, NR2B1 antibody, RXR antibody, rxra antibody, rxrg antibody, retinoid X receptor gamma antibody, retinoid X receptor, gamma b antibody, retinoid X receptor gamma L homeolog antibody, retinoid x receptor, gamma a antibody, RXRG antibody, rxrgb antibody, rxrg.L antibody, rxrg antibody, Rxrg antibody, RXRGAMMA antibody, rxrga antibody
- Background
- RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-