ESRRA antibody (N-Term)
-
- Target See all ESRRA Antibodies
- ESRRA (Estrogen-Related Receptor alpha (ESRRA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ESRRA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ESRRA antibody was raised against the N terminal of ESRRA
- Purification
- Affinity purified
- Immunogen
- ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
- Top Product
- Discover our top product ESRRA Primary Antibody
-
anti-Estrogen-Related Receptor alpha (ESRRA) antibody
ESRRA Reactivity: Human, Mouse, Rat IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 1-423) antibodyESRRA Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 131-159) antibodyESRRA Reactivity: Human WB, IF, IHC (p), FACS Host: Rabbit Polyclonal RB22490 unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 198-376) antibodyESRRA Reactivity: Human WB, ELISA, FACS Host: Mouse Monoclonal 6F1E6 unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 1-423) antibodyESRRA Reactivity: Human WB, IF, IP Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) antibodyESRRA Reactivity: Human WB, IHC (p), IP, ChIP Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 1-423) antibodyESRRA Reactivity: Human IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (Ligand Binding Domain) antibodyESRRA Reactivity: Human, Mouse, Rat, Dog, Cow, Horse, Pig, Bat, Monkey, Hamster IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (Internal Region) antibodyESRRA Reactivity: Human, Mouse, Rat, Dog, Cow, Horse, Pig, Bat, Monkey, Hamster IHC, IHC (p), ChIP Host: Rabbit Polyclonal unconjugated
anti-Estrogen-Related Receptor alpha (ESRRA) (AA 231-330) antibodyESRRA Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ESRRA Blocking Peptide, catalog no. 33R-4336, is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRRA (Estrogen-Related Receptor alpha (ESRRA))
- Alternative Name
- ESRRA (ESRRA Products)
- Background
- ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-
