Retinoid X Receptor beta antibody (N-Term)
-
- Target See all Retinoid X Receptor beta (RXRB) Antibodies
- Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoid X Receptor beta antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RXRB antibody was raised against the N terminal of RXRB
- Purification
- Affinity purified
- Immunogen
- RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
- Top Product
- Discover our top product RXRB Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RXRB Blocking Peptide, catalog no. 33R-6089, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))
- Alternative Name
- RXRB (RXRB Products)
- Synonyms
- DAUDI6 antibody, H-2RIIBP antibody, NR2B2 antibody, RCoR-1 antibody, RXR-beta antibody, RXRbeta antibody, rxrb antibody, RXRB antibody, nr2b2 antibody, daudi6 antibody, rcor-1 antibody, h-2riibp antibody, NR2B2-A antibody, RXR antibody, RXRA antibody, etID309733.19 antibody, rxre antibody, wu:fb93c09 antibody, AL023085 antibody, Nr2b2 antibody, Rub antibody, rxrd antibody, unp286 antibody, retinoid X receptor beta antibody, retinoid X receptor beta S homeolog antibody, retinoid x receptor, beta a antibody, retinoid x receptor, beta b antibody, RXRB antibody, Rxrb antibody, rxrb.S antibody, rxrb antibody, rxrba antibody, rxrbb antibody
- Background
- RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-