Retinoid X Receptor beta antibody (N-Term)

Catalog No. ABIN630492

Product Details anti-Retinoid X Receptor beta Antibody

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoid X Receptor beta antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RXRB antibody was raised against the N terminal of RXRB

Purification: Affinity purified

Immunogen: RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RXRB Blocking Peptide, catalog no. 33R-6089, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoid X Receptor beta

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Alternative Name: RXRB (RXRB Products)

Synonyms: DAUDI6 antibody, H-2RIIBP antibody, NR2B2 antibody, RCoR-1 antibody, RXR-beta antibody, RXRbeta antibody, rxrb antibody, RXRB antibody, nr2b2 antibody, daudi6 antibody, rcor-1 antibody, h-2riibp antibody, NR2B2-A antibody, RXR antibody, RXRA antibody, etID309733.19 antibody, rxre antibody, wu:fb93c09 antibody, AL023085 antibody, Nr2b2 antibody, Rub antibody, rxrd antibody, unp286 antibody, retinoid X receptor beta antibody, retinoid X receptor beta S homeolog antibody, retinoid x receptor, beta a antibody, retinoid x receptor, beta b antibody, RXRB antibody, Rxrb antibody, rxrb.S antibody, rxrb antibody, rxrba antibody, rxrbb antibody

Background: RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway