EMP2 antibody (Middle Region)

Catalog No. ABIN630488

Product Details anti-EMP2 Antibody

Target: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EMP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EMP2 antibody was raised against the middle region of EMP2

Purification: Purified

Immunogen: EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EMP2 Blocking Peptide, catalog no. 33R-4116, is also available for use as a blocking control in assays to test for specificity of this EMP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EMP2

Target: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Alternative Name: EMP2 (EMP2 Products)

Synonyms: MGC52916 antibody, MGC130799 antibody, MGC69514 antibody, emp2 antibody, XMP antibody, epithelial membrane protein 2 L homeolog antibody, epithelial membrane protein 2 antibody, emp2.L antibody, emp2 antibody, EMP2 antibody, Emp2 antibody

Background: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognised as a putative tumor suppressor gene in certain model systems.

Molecular Weight: 18 kDa (MW of target protein)