CHST7 antibody

Catalog No. ABIN630479

Product Details anti-CHST7 Antibody

Target: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Reactivity: Mouse, Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHST7 Blocking Peptide, catalog no. 33R-2045, is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST7

Target: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Alternative Name: CHST7 (CHST7 Products)

Synonyms: MGC130614 antibody, C6ST-2 antibody, GST-5 antibody, Gn6st-4 antibody, 2600013M07Rik antibody, GST5 antibody, carbohydrate sulfotransferase 7 antibody, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 L homeolog antibody, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 antibody, carbohydrate (N-acetylglucosamino) sulfotransferase 7 antibody, CHST7 antibody, chst7.L antibody, chst7 antibody, Chst7 antibody

Background: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process