VSIG4 antibody (N-Term)

Catalog No. ABIN630478

Product Details anti-VSIG4 Antibody

Target: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VSIG4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VSIG4 antibody was raised against the N terminal of VSIG4

Purification: Purified

Immunogen: VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VSIG4

Target: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Alternative Name: VSIG4 (VSIG4 Products)

Synonyms: DKFZp468O0322 antibody, CRIg antibody, Z39IG antibody, A530061A11 antibody, BC025105 antibody, V-set and immunoglobulin domain containing 4 antibody, VSIG4 antibody, Vsig4 antibody

Background: T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Molecular Weight: 44 kDa (MW of target protein)