VSIG4 antibody (N-Term)
-
- Target See all VSIG4 Antibodies
- VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VSIG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VSIG4 antibody was raised against the N terminal of VSIG4
- Purification
- Purified
- Immunogen
- VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
- Top Product
- Discover our top product VSIG4 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))
- Alternative Name
- VSIG4 (VSIG4 Products)
- Background
- T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
- Molecular Weight
- 44 kDa (MW of target protein)
-