MBOAT7 antibody (C-Term)
-
- Target See all MBOAT7 Antibodies
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MBOAT7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LENG4 antibody was raised against the C terminal Of Leng4
- Purification
- Purified
- Immunogen
- LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
- Top Product
- Discover our top product MBOAT7 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LENG4 Blocking Peptide, catalog no. 33R-5412, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
- Alternative Name
- LENG4 (MBOAT7 Products)
- Background
- The function of LENG4 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-