MBOAT7 antibody (C-Term)

Catalog No. ABIN630475

Product Details anti-MBOAT7 Antibody

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBOAT7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LENG4 antibody was raised against the C terminal Of Leng4

Purification: Purified

Immunogen: LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LENG4 Blocking Peptide, catalog no. 33R-5412, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBOAT7

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Alternative Name: LENG4 (MBOAT7 Products)

Synonyms: BB1 antibody, LENG4 antibody, LPIAT antibody, LRC4 antibody, MBOA7 antibody, OACT7 antibody, hMBOA-7 antibody, 5730589L02Rik antibody, Leng4 antibody, Lpiat antibody, mBB1 antibody, RGD1306945 antibody, membrane bound O-acyltransferase domain containing 7 antibody, Lysophospholipid acyltransferase 7 antibody, MBOAT7 antibody, Mboat7 antibody, mboa-7 antibody

Background: The function of LENG4 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process