TOR1B antibody
-
- Target See all TOR1B Antibodies
- TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOR1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- TOR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
- Top Product
- Discover our top product TOR1B Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOR1B Blocking Peptide, catalog no. 33R-9534, is also available for use as a blocking control in assays to test for specificity of this TOR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))
- Alternative Name
- TOR1B (TOR1B Products)
- Background
- TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.
- Molecular Weight
- 38 kDa (MW of target protein)
-