TOR1B antibody

Catalog No. ABIN630472

Product Details anti-TOR1B Antibody

Target: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOR1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: TOR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOR1B Blocking Peptide, catalog no. 33R-9534, is also available for use as a blocking control in assays to test for specificity of this TOR1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOR1B

Target: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Alternative Name: TOR1B (TOR1B Products)

Synonyms: MGC82811 antibody, tor1a antibody, 2610016F05Rik antibody, DQ1 antibody, torsinB antibody, torsin family 1, member B (torsin B) L homeolog antibody, torsin family 1, member B (torsin B) antibody, torsin family 1 member B antibody, torsin family 1, member B antibody, tor1b.L antibody, tor1b antibody, TOR1B antibody, Tor1b antibody

Background: TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.

Molecular Weight: 38 kDa (MW of target protein)