Melanoma gp100 antibody

Catalog No. ABIN630469

Product Details anti-Melanoma gp100 Antibody

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Melanoma gp100 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogen: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SILV Blocking Peptide, catalog no. 33R-3727, is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Melanoma gp100

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Alternative Name: SILV (PMEL Products)

Background: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Molecular Weight: 70 kDa (MW of target protein)