Melanoma gp100 antibody

Catalog No. ABIN630469

Product Details anti-Melanoma gp100 Antibody

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Melanoma gp100 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogen: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SILV Blocking Peptide, catalog no. 33R-3727, is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Melanoma gp100

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Alternative Name: SILV (PMEL Products)

Synonyms: D12S53E antibody, ME20 antibody, ME20-M antibody, ME20M antibody, P1 antibody, P100 antibody, PMEL17 antibody, SI antibody, SIL antibody, SILV antibody, gp100 antibody, D10H12S53E antibody, D12S53Eh antibody, Pmel17 antibody, Si antibody, Silv antibody, gp87 antibody, RPE1 antibody, MMP115 antibody, silverb antibody, silver antibody, cb397 antibody, fdv antibody, pmel17 antibody, sb:cb397 antibody, silva antibody, wu:fc11g11 antibody, wu:fj24g11 antibody, zgc:136622 antibody, premelanosome protein antibody, premelanosome protein b antibody, premelanosome protein a antibody, PMEL antibody, Pmel antibody, pmelb antibody, pmela antibody

Background: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Molecular Weight: 70 kDa (MW of target protein)