Calmegin antibody (N-Term)

Catalog No. ABIN630467

Product Details anti-Calmegin Antibody

Target: Calmegin (CLGN)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calmegin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calmegin antibody was raised against the N terminal of CLGN

Purification: Purified

Immunogen: Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calmegin Blocking Peptide, catalog no. 33R-10157, is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calmegin

Target: Calmegin (CLGN)

Alternative Name: Calmegin (CLGN Products)

Synonyms: 4930459O04Rik antibody, AI528775 antibody, Cln antibody, canx antibody, fj49d10 antibody, wu:fj24b04 antibody, wu:fj49d10 antibody, zgc:153946 antibody, CLGN antibody, calmegin antibody, CLGN antibody, Clgn antibody, clgn antibody

Background: Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.

Molecular Weight: 70 kDa (MW of target protein)