TMPRSS11D antibody (N-Term)
-
- Target See all TMPRSS11D Antibodies
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMPRSS11D antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TMPRSS11 D antibody was raised against the N terminal of TMPRSS11
- Purification
- Purified
- Immunogen
- TMPRSS11 D antibody was raised using the N terminal of TMPRSS11 corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMPRSS11D Blocking Peptide, catalog no. 33R-8213, is also available for use as a blocking control in assays to test for specificity of this TMPRSS11D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
- Alternative Name
- TMPRSS11D (TMPRSS11D Products)
- Background
- TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process
-