CHST1 antibody

Catalog No. ABIN630465

Product Details anti-CHST1 Antibody

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHST1 Blocking Peptide, catalog no. 33R-8443, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST1

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Alternative Name: CHST1 (CHST1 Products)

Synonyms: C6ST antibody, GST-1 antibody, KS6ST antibody, KSGal6ST antibody, KSST antibody, sulfo1 antibody, 2610008E20Rik antibody, AW125896 antibody, Gst1 antibody, KSGAL6ST antibody, carbohydrate sulfotransferase 1 antibody, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 antibody, CHST1 antibody, Chst1 antibody

Background: CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process