Butyrylcholinesterase antibody (N-Term)

Catalog No. ABIN630462

Product Details anti-Butyrylcholinesterase Antibody

Target: Butyrylcholinesterase (BCHE)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Butyrylcholinesterase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: BCHE antibody was raised against the N terminal of BCHE

Purification: Purified

Immunogen: BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCHE Blocking Peptide, catalog no. 33R-8821, is also available for use as a blocking control in assays to test for specificity of this BCHE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Butyrylcholinesterase

Target: Butyrylcholinesterase (BCHE)

Alternative Name: BCHE (BCHE Products)

Synonyms: che antibody, che1 antibody, bche antibody, cholinesterase antibody, CHE1 antibody, CHE2 antibody, E1 antibody, C730038G20Rik antibody, butyrylcholinesterase L homeolog antibody, butyrylcholinesterase antibody, bche.L antibody, bche antibody, BCHE antibody, Bche antibody

Background: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism