TM9SF1 antibody (N-Term)

Catalog No. ABIN630456

Product Details anti-TM9SF1 Antibody

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM9SF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TM9 SF1 antibody was raised against the N terminal of TM9 F1

Purification: Purified

Immunogen: TM9 SF1 antibody was raised using the N terminal of TM9 F1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM9SF1 Blocking Peptide, catalog no. 33R-2450, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM9SF1

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Alternative Name: TM9SF1 (TM9SF1 Products)

Synonyms: TM9SF1 antibody, fa03b09 antibody, wu:fa03b09 antibody, zgc:100810 antibody, HMP70 antibody, MP70 antibody, 1200014D02Rik antibody, AI893436 antibody, transmembrane 9 superfamily member 1 antibody, transmembrane 9 superfamily member 1 L homeolog antibody, TM9SF1 antibody, tm9sf1 antibody, tm9sf1.L antibody, Tm9sf1 antibody

Background: TM9SF1 may function as channel, small molecule transporter or receptor.

Molecular Weight: 67 kDa (MW of target protein)