SULF2 antibody (C-Term)
-
- Target See all SULF2 Antibodies
- SULF2 (Sulfatase 2 (SULF2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULF2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SULF2 antibody was raised against the C terminal of SULF2
- Purification
- Purified
- Immunogen
- SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW
- Top Product
- Discover our top product SULF2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULF2 Blocking Peptide, catalog no. 33R-2218, is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULF2 (Sulfatase 2 (SULF2))
- Alternative Name
- SULF2 (SULF2 Products)
- Background
- Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.
- Molecular Weight
- 98 kDa (MW of target protein)
-