SULF2 antibody (C-Term)
-
- Target See all SULF2 Antibodies
- SULF2 (Sulfatase 2 (SULF2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULF2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SULF2 antibody was raised against the C terminal of SULF2
- Purification
- Purified
- Immunogen
- SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW
- Top Product
- Discover our top product SULF2 Primary Antibody
-
anti-Sulfatase 2 (SULF2) (AA 337-654) antibody
SULF2 Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 463-660) antibodySULF2 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 337-649) antibodySULF2 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (C-Term) antibodySULF2 Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Pig WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 651-750) antibodySULF2 Reactivity: Rat WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 801-850) antibodySULF2 Reactivity: Human, Cow, Dog, Horse, Rabbit, Monkey, Bat, Hamster WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 824-852), (C-Term) antibodySULF2 Reactivity: Human WB Host: Rabbit Polyclonal RB31333 unconjugated
anti-Sulfatase 2 (SULF2) (Internal Region) antibodyVerified SULF2 Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 1-149) antibodySULF2 Reactivity: Human ELISA Host: Mouse Monoclonal 2H5 unconjugated
anti-Sulfatase 2 (SULF2) (AA 831-860), (C-Term) antibodySULF2 Reactivity: Human, Mouse WB, EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULF2 Blocking Peptide, catalog no. 33R-2218, is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULF2 (Sulfatase 2 (SULF2))
- Alternative Name
- SULF2 (SULF2 Products)
- Synonyms
- Sulf1 antibody, zgc:55612 antibody, SULF2 antibody, si:dkeyp-84g9.1 antibody, wu:fb48e04 antibody, HSULF-2 antibody, xtsulf2 antibody, 2010004N24Rik antibody, AU020235 antibody, MSulf-2 antibody, mKIAA1247 antibody, sulfatase 2a antibody, sulfatase 2 antibody, extracellular sulfatase Sulf-2 antibody, sulfatase 2b antibody, sulfatase 2 S homeolog antibody, sulf2a antibody, SULF2 antibody, LOC100540921 antibody, sulf2 antibody, sulf2b antibody, sulf2.S antibody, Sulf2 antibody
- Background
- Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.
- Molecular Weight
- 98 kDa (MW of target protein)
-
