PIGV antibody (N-Term)

Catalog No. ABIN630452

Product Details anti-PIGV Antibody

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Binding Specificity: N-Term

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGV antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PIGV antibody was raised against the N terminal of PIGV

Purification: Purified

Immunogen: PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGV Blocking Peptide, catalog no. 33R-3111, is also available for use as a blocking control in assays to test for specificity of this PIGV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIGV

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Alternative Name: PIGV (PIGV Products)

Synonyms: GPI-MT-II antibody, HPMRS1 antibody, PIG-V antibody, B330013B03 antibody, D430024F16Rik antibody, RGD1309526 antibody, phosphatidylinositol glycan anchor biosynthesis class V antibody, zinc finger DHHC-type containing 18 antibody, phosphatidylinositol glycan anchor biosynthesis, class V antibody, PIGV antibody, ZDHHC18 antibody, Pigv antibody

Background: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Inositol Metabolic Process