PIGV antibody (N-Term)
-
- Target See all PIGV Antibodies
- PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIGV antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PIGV antibody was raised against the N terminal of PIGV
- Purification
- Purified
- Immunogen
- PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
- Top Product
- Discover our top product PIGV Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIGV Blocking Peptide, catalog no. 33R-3111, is also available for use as a blocking control in assays to test for specificity of this PIGV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))
- Alternative Name
- PIGV (PIGV Products)
- Background
- Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-