ST3GAL5 antibody (N-Term)
-
- Target See all ST3GAL5 Antibodies
- ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST3GAL5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ST3 GAL5 antibody was raised against the N terminal of ST3 AL5
- Purification
- Purified
- Immunogen
- ST3 GAL5 antibody was raised using the N terminal of ST3 AL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
- Top Product
- Discover our top product ST3GAL5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST3GAL5 Blocking Peptide, catalog no. 33R-2160, is also available for use as a blocking control in assays to test for specificity of this ST3GAL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))
- Alternative Name
- ST3GAL5 (ST3GAL5 Products)
- Background
- Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.
- Molecular Weight
- 48 kDa (MW of target protein)
-