LMAN1 antibody (Middle Region)
-
- Target See all LMAN1 Antibodies
- LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LMAN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LMAN1 antibody was raised against the middle region of LMAN1
- Purification
- Purified
- Immunogen
- LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR
- Top Product
- Discover our top product LMAN1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LMAN1 Blocking Peptide, catalog no. 33R-2022, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))
- Alternative Name
- LMAN1 (LMAN1 Products)
- Synonyms
- ERGIC-53 antibody, ERGIC53 antibody, F5F8D antibody, FMFD1 antibody, MCFD1 antibody, MR60 antibody, gp58 antibody, 2610020P13Rik antibody, AI326273 antibody, AU043785 antibody, C730041J05 antibody, P58 antibody, p58 antibody, LMAN1 antibody, cpx-iii antibody, cpxiii antibody, lman1 antibody, wu:fc54c09 antibody, wu:fi36e01 antibody, Xp58 antibody, lman1-a antibody, lectin, mannose binding 1 antibody, lectin, mannose-binding, 1 antibody, complexin 3 antibody, lectin, mannose binding 1 S homeolog antibody, LMAN1 antibody, Lman1 antibody, cplx3 antibody, lman1 antibody, lman1.S antibody
- Background
- LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.
- Molecular Weight
- 54 kDa (MW of target protein)
-