NPTN antibody (Middle Region)

Catalog No. ABIN630447

Product Details anti-NPTN Antibody

Target: NPTN (Neuroplastin (NPTN))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPTN antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Neuroplastin antibody was raised against the middle region of NPTN

Purification: Purified

Immunogen: Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NPTN

Target: NPTN (Neuroplastin (NPTN))

Alternative Name: Neuroplastin (NPTN Products)

Synonyms: SDFR1 antibody, GP55 antibody, GP65 antibody, SDR1 antibody, np55 antibody, np65 antibody, AW554172 antibody, Sdfr1 antibody, nptn antibody, zgc:77326 antibody, neuroplastin antibody, neuroplastin L homeolog antibody, neuroplastin b antibody, NPTN antibody, Nptn antibody, nptn.L antibody, nptnb antibody

Background: Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Regulation of long-term Neuronal Synaptic Plasticity