UGT3A2 antibody (N-Term)

Catalog No. ABIN630444

Product Details anti-UGT3A2 Antibody

Target: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT3A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT3 A2 antibody was raised against the N terminal of µgT3 2

Purification: Purified

Immunogen: UGT3 A2 antibody was raised using the N terminal of µgT3 2 corresponding to a region with amino acids HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT3A2 Blocking Peptide, catalog no. 33R-3804, is also available for use as a blocking control in assays to test for specificity of this µgT3A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT3A2

Target: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Alternative Name: UGT3A2 (UGT3A2 Products)

Synonyms: AI313915 antibody, UDPGT 3A1 antibody, ugt3a1 antibody, ugt3a2 antibody, UDP glycosyltransferase family 3 member A2 antibody, UDP glycosyltransferases 3 family, polypeptide A2 antibody, UDP glycosyltransferase 3 family, polypeptide A2 L homeolog antibody, UGT3A2 antibody, Ugt3a2 antibody, ugt3a2.L antibody

Background: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molecular Weight: 59 kDa (MW of target protein)