NEU1 antibody
-
- Target See all NEU1 Antibodies
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEU1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
- Top Product
- Discover our top product NEU1 Primary Antibody
-
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 47-415) antibody
NEU1 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 48-315) antibodyNEU1 Reactivity: Human WB, IHC, IHC (p) Host: Mouse Monoclonal 3D4 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 334-415) antibodyNEU1 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 3F9 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 11-40) antibodyNEU1 Reactivity: Human WB, IHC, ELISA, FACS Host: Rabbit Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 201-415) antibodyNEU1 Reactivity: Human IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 11-40) antibodyNEU1 Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB18511 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 188-214) antibodyNEU1 Reactivity: Human WB Host: Rabbit Polyclonal RB42166 unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 334-415) antibodyNEU1 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (Internal Region) antibodyNEU1 Reactivity: Human WB, ELISA, IP Host: Rabbit Polyclonal unconjugated
anti-Sialidase 1 (Lysosomal Sialidase) (NEU1) (AA 156-415) antibodyNEU1 Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NEU1 Blocking Peptide, catalog no. 33R-9913, is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
- Alternative Name
- NEU1 (NEU1 Products)
- Synonyms
- NANH antibody, NEU antibody, SIAL1 antibody, MGC81958 antibody, AA407268 antibody, AA407316 antibody, Aglp antibody, Apl antibody, Bat-7 antibody, Bat7 antibody, G9 antibody, Map-2 antibody, Neu antibody, Neu-1 antibody, neuraminidase 1 antibody, neuraminidase 1 (lysosomal sialidase) L homeolog antibody, NEU1 antibody, neu1.L antibody, neu1 antibody, Neu1 antibody
- Background
- NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
