IL-10RA antibody (N-Term)
-
- Target See all IL-10RA (IL10RA) Antibodies
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL-10RA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL10 R Alpha antibody was raised against the N terminal of IL10 A
- Purification
- Purified
- Immunogen
- IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
- Top Product
- Discover our top product IL10RA Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
- Alternative Name
- IL10R alpha (IL10RA Products)
- Synonyms
- IL10R1 antibody, IL10RA antibody, CD210 antibody, CD210a antibody, CDW210A antibody, HIL-10R antibody, IL-10R1 antibody, IL10R antibody, AW553859 antibody, CDw210 antibody, CDw210a antibody, Il10r antibody, mIL-10R antibody, interleukin 10 receptor subunit alpha antibody, interleukin 10 receptor, alpha antibody, IL10RA antibody, Il10ra antibody
- Background
- IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Growth Factor Binding
-