PPIB antibody

Catalog No. ABIN630436

Product Details anti-PPIB Antibody

Target: PPIB (Cyclophilin B (PPIB))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIB Blocking Peptide, catalog no. 33R-2937, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIB

Target: PPIB (Cyclophilin B (PPIB))

Alternative Name: PPIB (PPIB Products)

Synonyms: cypb antibody, scylp antibody, cyp-s1 antibody, PPIB antibody, Ppib antibody, ACYPI004891 antibody, AA408962 antibody, AA553318 antibody, AI844835 antibody, Cphn-2 antibody, Cphn2 antibody, CyP-20b antibody, CypB antibody, Scylp antibody, CYP-S1 antibody, CYPB antibody, OI9 antibody, SCYLP antibody, cb87 antibody, sb:cb87 antibody, wu:fa97f08 antibody, zgc:73214 antibody, zgc:86796 antibody, peptidylprolyl isomerase B antibody, peptidylprolyl isomerase B (cyclophilin B) antibody, peptidylprolyl isomerase B L homeolog antibody, ppib antibody, PPIB antibody, Ppib antibody, CC1G_03223 antibody, ppib.L antibody

Background: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Molecular Weight: 24 kDa (MW of target protein)