Glucuronidase beta antibody (C-Term)
-
- Target See all Glucuronidase beta (GUSB) Antibodies
- Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glucuronidase beta antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- GUSB antibody was raised against the C terminal of GUSB
- Purification
- Purified
- Immunogen
- GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
- Top Product
- Discover our top product GUSB Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GUSB Blocking Peptide, catalog no. 33R-9662, is also available for use as a blocking control in assays to test for specificity of this GUSB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))
- Alternative Name
- GUSB (GUSB Products)
- Synonyms
- GUSB antibody, beta-GUS antibody, gus antibody, BG antibody, MPS7 antibody, AI747421 antibody, Gur antibody, Gus antibody, Gus-r antibody, Gus-s antibody, Gus-t antibody, Gus-u antibody, Gut antibody, asd antibody, g antibody, Ac2-223 antibody, si:ch211-160e1.7 antibody, si:ct573103.7 antibody, glucuronidase beta antibody, beta-D-glucuronidase antibody, beta-glucuronidase antibody, beta glucuronidase antibody, glucuronidase, beta antibody, GUSB antibody, bglR antibody, SSO_RS14735 antibody, Glu antibody, Gusb antibody, gusb antibody
- Background
- GUSB plays an important role in the degradation of dermatan and keratan sulfates.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-