MGAT2 antibody

Catalog No. ABIN630430

Product Details anti-MGAT2 Antibody

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MGAT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGAT2 Blocking Peptide, catalog no. 33R-7174, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MGAT2

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Alternative Name: MGAT2 (MGAT2 Products)

Background: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.

Molecular Weight: 51 kDa (MW of target protein)