ADAM30 antibody (N-Term)

Catalog No. ABIN630427

Product Details anti-ADAM30 Antibody

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM30 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAM30 antibody was raised against the N terminal of ADAM30

Purification: Purified

Immunogen: ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM30 Blocking Peptide, catalog no. 33R-8040, is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM30

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Alternative Name: ADAM30 (ADAM30 Products)

Synonyms: svph4 antibody, 4933424D07Rik antibody, ADAM metallopeptidase domain 30 antibody, a disintegrin and metallopeptidase domain 30 antibody, ADAM30 antibody, Adam30 antibody

Background: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.

Molecular Weight: 66 kDa (MW of target protein)