SDF4 antibody (C-Term)

Catalog No. ABIN630423

Product Details anti-SDF4 Antibody

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDF4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SDF4 antibody was raised against the C terminal of SDF4

Purification: Purified

Immunogen: SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDF4 Blocking Peptide, catalog no. 33R-4609, is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDF4

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Alternative Name: SDF4 (SDF4 Products)

Synonyms: Cab45 antibody, SDF-4 antibody, MGC107861 antibody, wu:fb66d06 antibody, wu:fd46e11 antibody, zgc:56577 antibody, zgc:76916 antibody, CAB45 antibody, stromal cell derived factor 4 antibody, stromal cell derived factor 4 L homeolog antibody, SDF4 antibody, sdf4 antibody, sdf4.L antibody, Sdf4 antibody

Background: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Molecular Weight: 39 kDa (MW of target protein)