SLC35B1 antibody (C-Term)

Catalog No. ABIN630422

Product Details anti-SLC35B1 Antibody

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 B1 antibody was raised against the C terminal of SLC35 1

Purification: Purified

Immunogen: SLC35 B1 antibody was raised using the C terminal of SLC35 1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35B1 Blocking Peptide, catalog no. 33R-1334, is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35B1

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Alternative Name: SLC35B1 (SLC35B1 Products)

Synonyms: UGTREL1 antibody, Ugalt2 antibody, UGTrel1 antibody, ERNST antibody, UGALT2 antibody, ernst1 antibody, ERNST1 antibody, wu:fj99g11 antibody, zgc:92284 antibody, solute carrier family 35 member B1 antibody, solute carrier family 35, member B1 antibody, solute carrier family 35 member B1 L homeolog antibody, SLC35B1 antibody, Slc35b1 antibody, slc35b1 antibody, slc35b1.L antibody

Background: SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Molecular Weight: 35 kDa (MW of target protein)