TMEM8B antibody (Middle Region)

Catalog No. ABIN630419

Product Details anti-TMEM8B Antibody

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM8B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: C9 ORF127 antibody was raised against the middle region of C9 rf127

Purification: Purified

Immunogen: C9 ORF127 antibody was raised using the middle region of C9 rf127 corresponding to a region with amino acids THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF127 Blocking Peptide, catalog no. 33R-9108, is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF127 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM8B

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Alternative Name: C9ORF127 (TMEM8B Products)

Synonyms: TMEM8B antibody, C9orf127 antibody, NAG-5 antibody, NGX6 antibody, RP11-112J3.10 antibody, RGD1310012 antibody, 4930500O05Rik antibody, transmembrane protein 8B antibody, TMEM8B antibody, tmem8b antibody, Tmem8b antibody

Background: The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.

Molecular Weight: 52 kDa (MW of target protein)