GPR161 antibody (N-Term)

Catalog No. ABIN630418

Product Details anti-GPR161 Antibody

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR161 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GPR161 antibody was raised against the N terminal of GPR161

Purification: Purified

Immunogen: GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR161 Blocking Peptide, catalog no. 33R-6464, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR161

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Alternative Name: GPR161 (GPR161 Products)

Synonyms: RE2 antibody, Gm208 antibody, Gm208Gpr antibody, vl antibody, RGD1563245 antibody, si:bz20i5.4 antibody, si:rp71-20i5.4 antibody, G protein-coupled receptor 161 antibody, GPR161 antibody, Gpr161 antibody, gpr161 antibody

Background: GPR161 is orphan receptor.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: cAMP Metabolic Process