GPR161 antibody (N-Term)
-
- Target See all GPR161 Antibodies
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPR161 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- GPR161 antibody was raised against the N terminal of GPR161
- Purification
- Purified
- Immunogen
- GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
- Top Product
- Discover our top product GPR161 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPR161 Blocking Peptide, catalog no. 33R-6464, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Alternative Name
- GPR161 (GPR161 Products)
- Background
- GPR161 is orphan receptor.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-