FADS1 antibody (C-Term)
-
- Target See all FADS1 Antibodies
- FADS1 (Fatty Acid Desaturase 1 (FADS1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FADS1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- FADS1 antibody was raised against the C terminal of FADS1
- Purification
- Purified
- Immunogen
- FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
- Top Product
- Discover our top product FADS1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FADS1 Blocking Peptide, catalog no. 33R-3002, is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FADS1 (Fatty Acid Desaturase 1 (FADS1))
- Alternative Name
- FADS1 (FADS1 Products)
- Background
- FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-