FAR1 antibody (N-Term)

Catalog No. ABIN630402

Product Details anti-FAR1 Antibody

Target: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MLSTD2 antibody was raised against the N terminal Of Mlstd2

Purification: Purified

Immunogen: MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLSTD2 Blocking Peptide, catalog no. 33R-5390, is also available for use as a blocking control in assays to test for specificity of this MLSTD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAR1

Target: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Alternative Name: MLSTD2 (FAR1 Products)

Synonyms: MLSTD2 antibody, SDR10E1 antibody, 2600011M19Rik antibody, 2900034E22Rik antibody, 3732409C05Rik antibody, AI850429 antibody, Mlstd2 antibody, mlstd2 antibody, MQJ16.4 antibody, MQJ16_4 antibody, fatty acid reductase 1 antibody, fatty acyl-CoA reductase 1 antibody, fatty acyl CoA reductase 1 antibody, fatty acyl-CoA reductase 1 L homeolog antibody, fatty acid reductase 1 antibody, FAR1 antibody, Far1 antibody, far1.L antibody

Background: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.

Molecular Weight: 59 kDa (MW of target protein)